PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600601.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 207aa    MW: 23466.8 Da    PI: 8.3755
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600601.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1977131256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq   Lee F++n++++ +++e LA++l+L+ rqV vWFqNrRa+ k
  XP_009600601.1  77 RKKLRLTKEQSLLLEESFRQNHTLNPKQKEALAMQLKLKPRQVEVWFQNRRARSK 131
                     788899***********************************************98 PP

2HD-ZIP_I/II115.43.5e-3777165189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl+keq+ lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRAR k+kq+E ++e+Lkr++ +l+e+n+rL+kev+eLr+
  XP_009600601.1  77 RKKLRLTKEQSLLLEESFRQNHTLNPKQKEALAMQLKLKPRQVEVWFQNRRARSKLKQTELECEYLKRWFGSLTEQNRRLKKEVQELRA 165
                     69*************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-2065134IPR009057Homeodomain-like
PROSITE profilePS5007117.45973133IPR001356Homeobox domain
SMARTSM003891.3E-1675137IPR001356Homeobox domain
PfamPF000465.9E-1777131IPR001356Homeobox domain
CDDcd000863.34E-1577134No hitNo description
Gene3DG3DSA:1.10.10.602.3E-1877131IPR009057Homeodomain-like
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PfamPF021837.4E-10133166IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-20133176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAVMPENSTC LELTISIPGS SSSSSFPSSG EGGGYNLMRE LDINQVPSSG NINEEEISIE  60
EEEESCNINV VNGGRTRKKL RLTKEQSLLL EESFRQNHTL NPKQKEALAM QLKLKPRQVE  120
VWFQNRRARS KLKQTELECE YLKRWFGSLT EQNRRLKKEV QELRATKVGP PTVLSPHSCQ  180
PRPAPTLTMC PHCERVTATI IKDESKI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17480RTRKKLR
27581TRKKLRL
3125133RRARSKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600601.11e-151PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ0JKX13e-76HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ8S9N66e-76ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
SwissprotQ9XH383e-76HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A068TXK63e-99A0A068TXK6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000783292e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-60homeobox-leucine zipper protein 17